NDH-L Ava_2080 NAD(P)H-quinone oxidoreductase subunit L NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon- concentration (By similarity). ndhL NAD(P)H dehydrogenase I subunit L 70 MIVPLLYLALAGAYLLVVPVALMFYLKQRWYVVSSVERTFMYFLVFLFFPGLLVLSPFVNLRPRPRKIEV NDHL_ANAVT NDH-1 subunit L